PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G372400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 242aa    MW: 28170.7 Da    PI: 7.4249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G372400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-191663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd+ll ++v+++G g+W+t+ar  g++R  k+c++rw +yl
  Aqcoe3G372400.1.p 16 KGPWTAEEDKLLTEYVTLHGEGRWSTVARSAGLNRNSKSCRLRWVNYL 63
                       79********************************************97 PP

2Myb_DNA-binding521.6e-1669113147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg  T+eE+ +++++++ +G++ W+ Iar+++ gRt++++k++w+++
  Aqcoe3G372400.1.p  69 RGQLTPEEESIIIELHAVWGNK-WSMIARCLP-GRTDNEIKNYWRTH 113
                        7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1611163IPR017930Myb domain
SuperFamilySSF466891.2E-3113110IPR009057Homeodomain-like
SMARTSM007171.1E-151565IPR001005SANT/Myb domain
PfamPF002491.7E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-231770IPR009057Homeodomain-like
CDDcd001675.20E-111863No hitNo description
PROSITE profilePS5129424.29864118IPR017930Myb domain
SMARTSM007174.4E-1468116IPR001005SANT/Myb domain
PfamPF002499.6E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2471117IPR009057Homeodomain-like
CDDcd001676.09E-1173114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVGLGGWGFP EQGWRKGPWT AEEDKLLTEY VTLHGEGRWS TVARSAGLNR NSKSCRLRWV  60
NYLRPGLKRG QLTPEEESII IELHAVWGNK WSMIARCLPG RTDNEIKNYW RTHFKNKARS  120
SRADDKLSMR RRQRQEQQQQ QQGQLQQQQQ EPQLGDMEKV QYHMEQCEYR VAPVQCGQEM  180
DFMMFSNMEE QCFPMGLQRG VSSLDNIGED QGLWGSLWNL DDLHIQFNQM CDNFKPNQAA  240
S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032859.15e-79Myb domain protein 121
RefseqXP_011021440.12e-79PREDICTED: transcription factor MYB48-like
TrEMBLA0A061EFJ96e-79A0A061EFJ9_THECC; Myb domain protein 121
STRINGVIT_14s0083g01060.t012e-70(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.16e-64myb domain protein 121